PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.065530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 287aa    MW: 31647.2 Da    PI: 8.3422
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.065530.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.9e-142067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l  +    G g+W+ +ar  g+ R++k+c++rw +yl
   Cucsa.065530.1 20 KGLWSPEEDDKLMSYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 67
                     678*******************************************97 PP

2Myb_DNA-binding50.54.9e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l+++++ +lG++ W+ Ia++++ gRt++++k++w++
   Cucsa.065530.1  73 RGAFSPQEEHLIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 116
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2371567IPR017930Myb domain
SuperFamilySSF466891.37E-2718114IPR009057Homeodomain-like
SMARTSM007172.4E-91969IPR001005SANT/Myb domain
PfamPF002493.7E-132067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-222174IPR009057Homeodomain-like
CDDcd001676.69E-82367No hitNo description
PROSITE profilePS5129425.23768122IPR017930Myb domain
SMARTSM007173.0E-1472120IPR001005SANT/Myb domain
PfamPF002493.8E-1573116IPR001005SANT/Myb domain
CDDcd001675.66E-1075115No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2575123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MRKPEATGAS GTSTTTKLRK GLWSPEEDDK LMSYMLNNGQ GCWSDVARNA GLQRCGKSCR  60
LRWINYLRPD LKRGAFSPQE EHLIIHLHSL LGNRWSQIAA RLPGRTDNEI KNFWNSTIKK  120
RLKNLSSTPS PNTSSTGSPS TDSKPNLFGG LLSSQDQQQQ SQGLMDEFPI YASDPIIGLD  180
PFPFVSAHGG PFFSTTTPTF TTGVEPSFFH EDHESFFGNL PLLQSVNTTT TVTATAVVER  240
SLKSETIVKE ANHSNYLINN INCLANHNNF SNNNNPKTTD NNINGGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27181225108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818420.0LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004142224.10.0PREDICTED: transcription factor MYB82-like
TrEMBLD7SL502e-87D7SL50_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g02110.t017e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.14e-65myb domain protein 46